Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP kinase-activated protein kinase 2
LigandBDBM50395300
Substrate/Competitorn/a
Meas. Tech.ChEMBL_860552
IC50 8700±n/a nM
Citation Kosugi, TMitchell, DRFujino, AImai, MKambe, MKobayashi, SMakino, HMatsueda, YOue, YKomatsu, KImaizumi, KSakai, YSugiura, STakenouchi, OUnoki, GYamakoshi, YCunliffe, VFrearson, JGordon, RHarris, CJKalloo-Hosein, HLe, JPatel, GSimpson, DJSherborne, BThomas, PSSuzuki, NTakimoto-Kamimura, MKataoka, K Mitogen-activated protein kinase-activated protein kinase 2 (MAPKAP-K2) as an antiinflammatory target: discovery and in vivo activity of selective pyrazolo[1,5-a]pyrimidine inhibitors using a focused library and structure-based optimization approach. J Med Chem55:6700-15 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
MAP kinase-activated protein kinase 2
Name:MAP kinase-activated protein kinase 2
Synonyms:MAP kinase-activated protein kinase 2 (MAPKAPK2) | MAP kinase-activated protein kinase 2 (MK2) | MAP kinase-activated protein kinase 2 (p38/MK2) | MAPK-Activated Protein Kinase 2 (MK2) | MAPK-activated protein kinase 2 | MAPKAP kinase 2 | MAPKAPK-2 | MAPKAPK2 | MK2
Type:Serine/threonine-protein kinase
Mol. Mass.:45579.87
Organism:Homo sapiens (Human)
Description:P49137
Residue:400
Sequence:
MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAII
DDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRI
VDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSI
NIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKY
DKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKM
LIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSAL
ATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50395300
n/a
NameBDBM50395300
Synonyms:CHEMBL2163978
TypeSmall organic molecule
Emp. Form.C18H24N6O
Mol. Mass.340.4228
SMILESCCOc1ccc(Nc2c(C)c(NCCCN)nc3ccnn23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: