Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM50396382
Substrate/Competitorn/a
Meas. Tech.ChEMBL_861906
Ki 13.3±n/a nM
Citation Díaz, JLCuberes, RBerrocal, JContijoch, MChristmann, UFernández, APort, AHolenz, JBuschmann, HLaggner, CSerafini, MTBurgueño, JZamanillo, DMerlos, MVela, JMAlmansa, C Synthesis and biological evaluation of the 1-arylpyrazole class ofs(1) receptor antagonists: identification of 4-{2-[5-methyl-1-(naphthalen-2-yl)-1H-pyrazol-3-yloxy]ethyl}morpholine (S1RA, E-52862). J Med Chem55:8211-24 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma non-opioid intracellular receptor 1
Synonyms:Aging-associated gene 8 protein | SIG-1R | SR-BP | SR31747-binding protein | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1
Type:Enzyme Catalytic Domain
Mol. Mass.:25124.85
Organism:Homo sapiens (Human)
Description:Q99720
Residue:223
Sequence:
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50396382
NameBDBM50396382
Synonyms:CHEMBL2170221
TypeSmall organic molecule
Emp. Form.C18H23Cl2N3O2
Mol. Mass.384.3
SMILESCc1cc(OCCCCN2CCOCC2)nn1-c1ccc(Cl)c(Cl)c1
Structure
n/a