Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone H4
LigandBDBM50397030
Substrate/Competitorn/a
Meas. Tech.ChEMBL_863123
Kd 23800±n/a nM
Citation Wang, JChen, LSinha, SHLiang, ZChai, HMuniyan, SChou, YWYang, CYan, LFeng, YLi, KKLin, MFJiang, HZheng, YGLuo, C Pharmacophore-based virtual screening and biological evaluation of small molecule inhibitors for protein arginine methylation. J Med Chem55:7978-87 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone H4
Name:Histone H4
Synonyms:H4/A | H4F2 | H4FA | H4FB | H4FC | H4FD | H4FE | H4FG | H4FH | H4FI | H4FJ | H4FK | H4FM | H4FN | H4FO | HIST2H4 | HIST4H4 | and | andH4/B | andH4/C | andH4/D | andH4/E | andH4/G | andH4/H | andH4/I | andH4/J | andH4/K | andH4/M | andH4/N | andH4/O
Type:Protein
Mol. Mass.:11386.36
Organism:Homo sapiens (Human)
Description:P62805
Residue:103
Sequence:
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50397030
NameBDBM50397030
Synonyms:CHEMBL2171189
TypeSmall organic molecule
Emp. Form.C35H24N2O5
Mol. Mass.552.5755
SMILESOc1ccc(cc1NC(=O)c1cccc2ccccc12)C(=O)c1ccc(O)c(NC(=O)c2cccc3ccccc23)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a