Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVasopressin V1b receptor
LigandBDBM35667
Substrate/Competitorn/a
Meas. Tech.ChEMBL_864198
Ki 0.49±n/a nM
Citation Loison, SCottet, MOrcel, HAdihou, HRahmeh, RLamarque, LTrinquet, EKellenberger, EHibert, MDurroux, TMouillac, BBonnet, D Selective fluorescent nonpeptidic antagonists for vasopressin V2 GPCR: application to ligand screening and oligomerization assays. J Med Chem55:8588-602 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vasopressin V1b receptor
Name:Vasopressin V1b receptor
Synonyms:AVPR V1b | AVPR V3 | Antidiuretic hormone receptor 1b | V1bR | VASOPRESSIN V1B | Vasopressin V3 | Vasopressin V3 receptor
Type:Enzyme
Mol. Mass.:46985.01
Organism:Homo sapiens (Human)
Description:P47901
Residue:424
Sequence:
MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLG
QLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFA
STYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQG
SGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVG
GGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSV
QMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQ
PRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAE
TIIF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM35667
NameBDBM35667
Synonyms:AVP | CHEMBL373742 | US10131692, 44 (AVP) | [3H]Arginine vasopressin | [3H]Argipressin tannate | [3H]vasopressin
Typeradiolabeled ligand
Emp. Form.C46H65N15O12S2
Mol. Mass.1084.232
SMILES[#7]-[#6@H]-1-[#6]-[#16]-[#16]-[#6]-[#6@H](-[#7]-[#6](=O)-[#6@H](-[#6]-[#6](-[#7])=O)-[#7]-[#6](=O)-[#6@H](-[#6]-[#6]-[#6](-[#7])=O)-[#7]-[#6](=O)-[#6@H](-[#6]-c2ccccc2)-[#7]-[#6](=O)-[#6@H](-[#6]-c2ccc(-[#8])cc2)-[#7]-[#6]-1=O)-[#6](=O)-[#7]-1-[#6]-[#6]-[#6]-[#6@H]-1-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](=O)-[#7]-[#6]-[#6](-[#7])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a