Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A1
LigandBDBM50053924
Substrate/Competitorn/a
Meas. Tech.ChEMBL_874130
Ki>10000±n/a nM
Citation Baraldi, PGPreti, DBorea, PAVarani, K Medicinal chemistry of A3 adenosine receptor modulators: pharmacological activities and therapeutic implications. J Med Chem55:5676-703 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A1
Name:Adenosine receptor
Synonyms:ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptors A1
Type:Protein
Mol. Mass.:36704.13
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:326
Sequence:
MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50053924
NameBDBM50053924
Synonyms:3,6-Dichloro-2-(2-isopropoxy-4-methyl-phenyl)-chromen-4-one | CHEMBL89093 | MRS1067
TypeSmall organic molecule
Emp. Form.C19H16Cl2O3
Mol. Mass.363.235
SMILESCC(C)Oc1cc(C)ccc1-c1oc2ccc(Cl)cc2c(=O)c1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a