Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-secretase 1 (BACE1)
LigandBDBM50398267
Substrate/Competitorn/a
Meas. Tech.ChEMBL_874707
IC50 3.4±n/a nM
Citation Swahn, BMKolmodin, KKarlström, Svon Berg, SSöderman, PHolenz, JBerg, SLindström, JSundström, MTurek, DKihlström, JSlivo, CAndersson, LPyring, DRotticci, DOhberg, LKers, ABogar, Kvon Kieseritzky, FBergh, MOlsson, LLJanson, JEketjäll, SGeorgievska, BJeppsson, FFälting, J Design and synthesis ofß-site amyloid precursor protein cleaving enzyme (BACE1) inhibitors with in vivo brain reduction ofß-amyloid peptides. J Med Chem55:9346-61 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-secretase 1 (BACE1)
Name:Beta-secretase 1 (BACE1)
Synonyms:Beta-secretase 1
Type:Enzyme
Mol. Mass.:55739.56
Organism:Mus musculus (Mouse)
Description:P56818
Residue:501
Sequence:
MAPALHWLLLWVGSGMLPAQGTHLGIRLPLRSGLAGPPLGLRLPRETDEESEEPGRRGSF
VEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSST
YRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGIL
GLAYAEIARPDDSLEPFFDSLVKQTHIPNIFSLQLCGAGFPLNQTEALASVGGSMIIGGI
DHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKK
VFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRIT
ILPQQYLRPVEDVATSQDDCYKFAVSQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSAC
HVHDEFRTAAVEGPFVTADMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQW
RCLRCLRHQHDDFADDISLLK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50398267
NameBDBM50398267
Synonyms:CHEMBL2177304
TypeSmall organic molecule
Emp. Form.C27H24FN3O
Mol. Mass.425.4974
SMILESCCn1cc(cc(C)c1=O)[C@@]1(N=C(N)c2c1cccc2F)c1cccc(c1)C#CC1CC1 |r,t:12|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a