Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcGMP-dependent protein kinase
LigandBDBM50398379
Substrate/Competitorn/a
Meas. Tech.ChEMBL_875871
IC50 98±n/a nM
Citation Blake, JFXu, RBencsik, JRXiao, DKallan, NCSchlachter, SMitchell, ISSpencer, KLBanka, ALWallace, EMGloor, SLMartinson, MWoessner, RDVigers, GPBrandhuber, BJLiang, JSafina, BSLi, JZhang, BChabot, CDo, SLee, LOeh, JSampath, DLee, BBLin, KLiederer, BMSkelton, NJ Discovery and preclinical pharmacology of a selective ATP-competitive Akt inhibitor (GDC-0068) for the treatment of human tumors. J Med Chem55:8110-27 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
cGMP-dependent protein kinase
Name:cGMP-dependent protein kinase
Synonyms:GMP-dependent protein kinase I | Protein Kinase G | cGMP-dependent protein kinase 1
Type:Protein
Mol. Mass.:76358.04
Organism:Homo sapiens (Human)
Description:Q13976
Residue:671
Sequence:
MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTR
AQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMY
PVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTAT
VKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEET
HYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDV
RTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDF
NIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF
IVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGI
IYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISAD
YWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS
ERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPP
PDDNSGWDIDF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50398379
NameBDBM50398379
Synonyms:CHEMBL2177390
TypeSmall organic molecule
Emp. Form.C24H32ClN5O2
Mol. Mass.457.996
SMILESCC(C)NC[C@@H](C(=O)N1CCN(CC1)c1ncnc2[C@H](O)C[C@@H](C)c12)c1ccc(Cl)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a