Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual-specificity tyrosine-phosphorylation regulated kinase 1A
LigandBDBM50399307
Substrate/Competitorn/a
Meas. Tech.ChEMBL_877314
IC50>10000±n/a nM
Citation Boulahjar, ROuach, AMatteo, CBourg, SRavache, Mle Guével, RMarionneau, SOullier, TLozach, OMeijer, LGuguen-Guillouzo, CLazar, SAkssira, MTroin, YGuillaumet, GRoutier, S Novel tetrahydropyrido[1,2-a]isoindolone derivatives (valmerins): potent cyclin-dependent kinase/glycogen synthase kinase 3 inhibitors with antiproliferative activities and antitumor effects in human tumor xenografts. J Med Chem55:9589-606 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual-specificity tyrosine-phosphorylation regulated kinase 1A
Name:Dual-specificity tyrosine-phosphorylation regulated kinase 1A
Synonyms:DYRK1A | Dual specificity YAK1-related kinase | Dual specificity YAK1-related kinase 1A (Dyrk1A) | Dual specificity tyrosine-phosphorylation-regulated kinase 1A (DYRK1A) | Dual-specificity tyrosine-regulated kinases 1A | HP86
Type:Enzyme
Mol. Mass.:85616.61
Organism:Homo sapiens (Human)
Description:Q13627
Residue:763
Sequence:
MHTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMPHSHQYSDRRQPNISDQQVSALSYSD
QIQQPLTNQVMPDIVMLQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQ
QGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRV
EQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEM
LSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKR
SAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPL
FSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWNLKKTKDGKREYKPPGT
RKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFK
KTADEGTNTSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGG
HFTAAVQAMDCETHSPQVRQQFPAPLGWSGTEAPTQVTVETHPVQETTFHVAPQQNALHH
HHGNSSHHHHHHHHHHHHHGQQALGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSS
STTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTY
QFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50399307
NameBDBM50399307
Synonyms:CHEMBL2180857
TypeSmall organic molecule
Emp. Form.C18H14Cl4N4O2
Mol. Mass.460.141
SMILESClc1nc(NC(=O)Nc2cccc3C(=O)N4CCCCC4c23)c(Cl)c(Cl)c1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a