Target
5-hydroxytryptamine receptor 4
Ligand
BDBM50399615
Substrate
n/a
Meas. Tech.
ChEMBL_878536
Ki
13.1±n/a nM
Citation
 Dubost, EDumas, NFossey, CMagnelli, RButt-Gueulle, SBallandonne, CCaignard, DHDulin, FSopkova de-Oliveira Santos, JMillet, PCharnay, YRault, SCailly, TFabis, F Synthesis and structure-affinity relationships of selective high-affinity 5-HT(4) receptor antagonists: application to the design of new potential single photon emission computed tomography tracers. J Med Chem 55:9693-707 (2012) [PubMed]  Article
Target
Name:
5-hydroxytryptamine receptor 4
Synonyms:
5-HT4 | 5-hydroxytryptamine receptor 4 | HTR4 | Serotonin 4 (5-HT4) receptor
Type:
Enzyme Catalytic Domain
Mol. Mass.:
43735.29
Organism:
GUINEA PIG
Description:
5-HT4 HTR4 GUINEA PIG::O70528
Residue:
388
Sequence:
MDKLDANVSSKEGFGSVEKVVLLTFLSAVILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWVYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPMFISFLPIMQGWNNIGIVDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHARQIQVLQRAGAPAEGRPQPADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQLWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDTVECGGQWESQCHPAASSPLVAAQPIDT
  
Inhibitor
Name:
BDBM50399615
Synonyms:
CHEMBL2181171
Type:
Small organic molecule
Emp. Form.:
C21H25N3O
Mol. Mass.:
335.4427
SMILES:
CCCN1CCC(COc2nc3ccccc3c3ncccc23)CC1
Structure:
Search PDB for entries with ligand similarity: