Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor protein alpha-7 subunit
LigandBDBM50399789
Substrate/Competitorn/a
Meas. Tech.ChEMBL_877370
Ki 6.2±n/a nM
Citation Mazurov, AAKombo, DCHauser, TAMiao, LDull, GGenus, JFFedorov, NBBenson, LSidach, SXiao, YHammond, PSJames, JWMiller, CHYohannes, D Discovery of (2S,3R)-N-[2-(Pyridin-3-ylmethyl)-1-azabicyclo[2.2.2]oct-3-yl]benzo[b]furan-2-carboxamide (TC-5619), a selectivea7 nicotinic acetylcholine receptor agonist, for the treatment of cognitive disorders. J Med Chem55:9793-809 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neuronal acetylcholine receptor protein alpha-7 subunit
Name:Neuronal acetylcholine receptor protein alpha-7 subunit
Synonyms:CHRNA7 | Cholinergic, Nicotinic Alpha7 | NACHRA7 | Neuronal acetylcholine receptor subunit alpha-7 | Neuronal acetylcholine receptor subunit alpha-7 (nAChR-alpha 7) | Nicotinic acetylcholine receptor alpha-7 (alpha7 nAChR)
Type:n/a
Mol. Mass.:56448.33
Organism:Homo sapiens (Human)
Description: CHRNA7 (NACHRA7)
Residue:502
Sequence:
MRCSPGGVWLALAASLLHVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLL
QIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADE
RFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDL
QMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIP
CVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFAST
MIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHK
QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHL
LHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTI
ICTIGILMSAPNFVEAVSKDFA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50399789
NameBDBM50399789
Synonyms:CHEMBL2179865
TypeSmall organic molecule
Emp. Form.C18H20BrN3O2
Mol. Mass.390.274
SMILESBrc1ccoc1C(=O)N[C@@H]1C2CCN(CC2)[C@H]1Cc1cccnc1 |r,wU:9.9,wD:16.19,(30.28,-39.8,;31.52,-40.71,;32.98,-40.24,;33.88,-41.48,;32.98,-42.71,;31.52,-42.24,;30.19,-43.01,;30.18,-44.55,;28.86,-42.23,;27.52,-43,;26.19,-42.22,;24.86,-43,;24.86,-44.54,;26.19,-45.3,;25.41,-43.96,;26.78,-43.46,;27.52,-44.54,;28.85,-45.31,;28.85,-46.85,;27.51,-47.61,;27.51,-49.15,;28.84,-49.93,;30.18,-49.15,;30.18,-47.61,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a