Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-X-C chemokine receptor type 4 (CXCR4)
LigandBDBM50042947
Substrate/Competitorn/a
Meas. Tech.ChEMBL_879520
Ki 53±n/a nM
Citation Gasparik, VDaubeuf, FHachet-Haas, MRohmer, FGizzi, PHaiech, JGalzi, JLHibert, MBonnet, DFrossard, N Prodrugs of a CXC Chemokine-12 (CXCL12) Neutraligand Prevent Inflammatory Reactions in an Asthma Model in Vivo. ACS Med Chem Lett3:10-14 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-X-C chemokine receptor type 4 (CXCR4)
Name:C-X-C chemokine receptor type 4
Synonyms:C-X-C chemokine receptor type 4 | CD_antigen=CD184 | CXC-R4 | CXCR-4 | FB22 | Fusin | HM89 | LCR1 | LESTR | Leukocyte-derived seven transmembrane domain receptor | NPYRL | SDF-1 receptor | Stromal cell-derived factor 1 receptor
Type:Enzyme
Mol. Mass.:39754.61
Organism:Homo sapiens (Human)
Description:P61073
Residue:352
Sequence:
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVI
LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNL
YSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA
DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT
TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50042947
NameBDBM50042947
Synonyms:1-(4-Chloro-phenyl)-3-(4-hydroxy-3-methoxy-phenyl)-propenone | 1-(4-chlorophenyl)-3-(4-hydroxy-3-methoxyphenyl)prop-2-en-1-one | 4'-chloro-3-methoxy-4-hydroxychalcone | CHEMBL126657 | Chalcone 4
TypeSmall organic molecule
Emp. Form.C16H13ClO3
Mol. Mass.288.726
SMILESCOc1cc(\C=C\C(=O)c2ccc(Cl)cc2)ccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a