Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5'-AMP-activated protein kinase catalytic subunit alpha-1
LigandBDBM50401152
Substrate/Competitorn/a
Meas. Tech.ChEMBL_881442
IC50<10000±n/a nM
Citation Sunose, MBell, KEllard, KBergamini, GNeubauer, GWerner, TRamsden, N Discovery of 5-(2-amino-[1,2,4]triazolo[1,5-a]pyridin-7-yl)-N-(tert-butyl)pyridine-3-sulfonamide (CZC24758), as a potent, orally bioavailable and selective inhibitor of PI3K for the treatment of inflammatory disease. Bioorg Med Chem Lett22:4613-8 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5'-AMP-activated protein kinase catalytic subunit alpha-1
Name:5'-AMP-activated protein kinase catalytic subunit alpha-1
Synonyms:5''-AMP-activated protein kinase catalytic subunit alpha-1 (AMPKa1) | 5''-AMP-activated protein kinase subunit alpha-1 | ACACA kinase | AMP-activated protein kinase, alpha-1 subunit | AMPK subunit alpha-1 | AMPK-alpha1 | Hydroxymethylglutaryl-CoA reductase kinase | Tau-protein kinase PRKAA1
Type:Protein
Mol. Mass.:64023.62
Organism:Homo sapiens (Human)
Description:Q13131
Residue:559
Sequence:
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
DEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDE
ITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPG
SHTIEFFEMCANLIKILAQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50401152
NameBDBM50401152
Synonyms:CHEMBL2205766
TypeSmall organic molecule
Emp. Form.C15H18N6O2S
Mol. Mass.346.407
SMILESCC(C)(C)NS(=O)(=O)c1cncc(c1)-c1ccn2nc(N)nc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a