Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetalpha-glucosidase (Gaa)
LigandBDBM50401967
Substrate/Competitorn/a
Meas. Tech.ChEMBL_886575
IC50 14130±n/a nM
Citation Patil, VSNandre, KPGhosh, SRao, VJChopade, BABhosale, SVBhosale, SV Synthesis and glycosidase inhibitory activity of novel (2-phenyl-4H-benzopyrimedo[2,1-b]-thiazol-4-yliden)acetonitrile derivatives. Bioorg Med Chem Lett22:7011-4 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
alpha-glucosidase (Gaa)
Name:alpha-glucosidase (Gaa)
Synonyms:α-Glucosidase | Acid maltase | Lysosomal alpha-glucosidase
Type:Enzyme
Mol. Mass.:106235.32
Organism:Mus musculus (Mouse)
Description:P70699
Residue:953
Sequence:
MNIRKPLCSNSVVGACTLISLTTAVILGHLMLRELMLLPQDLHESSSGLWKTYRPHHQEG
YKPGPLHIQEQTEQPKEAPTQCDVPPSSRFDCAPDKGISQEQCEARGCCYVPAGQVLKEP
QIGQPWCFFPPSYPSYRLENLSSTESGYTATLTRTSPTFFPKDVLTLQLEVLMETDSRLH
FKIKDPASKRYEVPLETPRVLSQAPSPLYSVEFSEEPFGVIVRRKLGGRVLLNTTVAPLF
FADQFLQLSTSLPSQHITGLGEHLSPLMLSTDWARITLWNRDTPPSQGTNLYGSHPFYLA
LEDGGLAHGVFLLNSNAMDVILQPSPALTWRSTGGILDVYVFLGPEPKSVVQQYLDVVGY
PFMPPYWGLGFHLCRWGYSSTAIVRQVVENMTRTHFPLDVQWNDLDYMDARRDFTFNQDS
FADFPDMVRELHQDGRRYMMIVDPAISSAGPAGSYRPYDEGLRRGVFITNETGQPLIGKV
WPGTTAFPDFTNPETLDWWQDMVSEFHAQVPFDGMWLDMNEPSNFVRGSQQGCPNNELEN
PPYVPGVVGGILQAATICASSHQFLSTHYNLHNLYGLTEAIASSRALVKTRGTRPFVISR
STFSGHGRYAGHWTGDVRSSWEHLAYSVPDILQFNLLGVPLVGADICGFIGDTSEELCVR
WTQLGAFYPFMRNHNDLNSVPQEPYRFSETAQQAMRKAFALRYALLPYLYTLFHRAHVRG
DTVARPLFLEFPEDPSTWSVDRQLLWGPALLITPVLEPGKTEVTGYFPKGTWYNMQMVSV
DSLGTLPSPSSASSFRSAVQSKGQWLTLEAPLDTINVHLREGYIIPLQGPSLTTTESRKQ
PMALAVALTASGEADGELFWDDGESLAVLERGAYTLVTFSAKNNTIVNKLVRVTKEGAEL
QLREVTVLGVATAPTQVLSNGIPVSNFTYSPDNKSLAIPVSLLMGELFQISWS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50401967
n/a
NameBDBM50401967
Synonyms:CHEMBL2207959
TypeSmall organic molecule
Emp. Form.C19H12BrN3OS
Mol. Mass.410.287
SMILESCOc1ccc2N3C(Sc2c1)=NC(=C\C3=C/C#N)c1ccc(Br)cc1 |c:12,14|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: