Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase AKT
LigandBDBM50402020
Substrate/Competitorn/a
Meas. Tech.ChEMBL_886829
Ki>9000±n/a nM
Citation Zhang, QXia, ZMitten, MJLasko, LMKlinghofer, VBouska, JJohnson, EFPenning, TDLuo, YGiranda, VLShoemaker, ARStewart, KDDjuric, SWVasudevan, A Hit to Lead optimization of a novel class of squarate-containing polo-like kinases inhibitors. Bioorg Med Chem Lett22:7615-22 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase AKT
Name:Serine/threonine-protein kinase AKT
Synonyms:AKT3 | PKB gamma | Protein kinase Akt-3 | Protein kinase B (Akt 3) | Protein kinase B, gamma | RAC-PK-gamma | RAC-gamma serine/threonine-protein kinase | STK-2 | Serine/threonine-protein kinase AKT3
Type:Enzyme
Mol. Mass.:55769.36
Organism:Homo sapiens (human)
Description:n/a
Residue:479
Sequence:
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50402020
NameBDBM50402020
Synonyms:CHEMBL2205426
TypeSmall organic molecule
Emp. Form.C23H22N6O2
Mol. Mass.414.4598
SMILESCC(C)(C)Nc1c(Nc2ccnc(Nc3ccc(cc3)-c3ccncc3)n2)c(=O)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a