Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlyoxalase 1 (GLO1)
LigandBDBM50402208
Substrate/Competitorn/a
Meas. Tech.ChEMBL_885082
IC50 280±n/a nM
Citation Chiba, TOhwada, JSakamoto, HKobayashi, TFukami, TAIrie, MMiura, TOhara, KKoyano, H Design and evaluation of azaindole-substituted N-hydroxypyridones as glyoxalase I inhibitors. Bioorg Med Chem Lett22:7486-9 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glyoxalase 1 (GLO1)
Name:Glyoxalase I
Synonyms:Aldoketomutase | Glx I | Glyoxalase I | Ketone-aldehyde mutase | Methylglyoxalase | S-D-lactoylglutathione methylglyoxal lyase
Type:Enzyme
Mol. Mass.:20772.95
Organism:Homo sapiens (Human)
Description:Q04760
Residue:184
Sequence:
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQK
CDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNS
DPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKM
ATLM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50402208
NameBDBM50402208
Synonyms:CHEMBL2203974
TypeSmall organic molecule
Emp. Form.C18H13N3O2
Mol. Mass.303.3147
SMILESOn1c(cc(cc1=O)-c1ccccc1)-c1cnc2[nH]ccc2c1
Structure
n/a