Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBone morphogenetic protein 1
LigandBDBM50402508
Substrate/Competitorn/a
Meas. Tech.ChEMBL_886679
IC50 1500000±n/a nM
Citation Turtle, EChow, NYang, CSosa, SBauer, UBrenner, MSolow-Cordero, DHo, WB Design and synthesis of procollagen C-proteinase inhibitors. Bioorg Med Chem Lett22:7397-401 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bone morphogenetic protein 1
Name:Bone morphogenetic protein 1
Synonyms:BMP-1 | Mammalian tolloid protein | PCP | Procollagen C-proteinase | mTld
Type:PROTEIN
Mol. Mass.:111254.03
Organism:Homo sapiens (Human)
Description:ChEMBL_518962
Residue:986
Sequence:
MPGVARLPLLLGLLLLPRPGRPLDLADYTYDLAEEDDSEPLNYKDPCKAAAFLGDIALDE
EDLRAFQVQQAVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRR
AATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTY
RPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVREN
IQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPPIG
QRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKI
ILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSS
NWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSF
EIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGF
AVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNG
SITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSK
LHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVN
TFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSKKECTWAISST
PGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGSRMFLR
FYSDNSVQRKGFQASHATECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGY
GVELVFQTFEVEEETDCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVKFHS
DDTITKKGFHLRYTSTKFQDTLHSRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50402508
n/a
NameBDBM50402508
Synonyms:CHEMBL2204842
TypeSmall organic molecule
Emp. Form.C12H19N3O8
Mol. Mass.333.2946
SMILESCNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NCC(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: