Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdvanced glycosylation end product-specific receptor
LigandBDBM50402574
Substrate/Competitorn/a
Meas. Tech.ChEMBL_886755
IC50 1910±n/a nM
Citation Lee, YSKim, HKim, YHRoh, EJHan, HShin, KJ Synthesis and structure-activity relationships of tri-substituted thiazoles as RAGE antagonists for the treatment of Alzheimer's disease. Bioorg Med Chem Lett22:7555-61 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Advanced glycosylation end product-specific receptor
Name:Advanced glycosylation end product-specific receptor
Synonyms:AGER | RAGE | Receptor for advanced glycosylation end products
Type:PROTEIN
Mol. Mass.:42800.11
Organism:Homo sapiens (Human)
Description:ChEMBL_1339877
Residue:404
Sequence:
MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEA
WKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQI
PGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRH
PETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQL
VVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS
CVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGV
ILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50402574
NameBDBM50402574
Synonyms:CHEMBL2205557
TypeSmall organic molecule
Emp. Form.C33H37ClN2O2S
Mol. Mass.561.177
SMILESCCCCc1sc(nc1-c1ccc(OCC2CCCN(CC)C2)cc1)-c1ccc(Oc2ccc(Cl)cc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a