Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C chemokine receptor type 3
LigandBDBM50402822
Substrate/Competitorn/a
Meas. Tech.ChEMBL_887257
Ki 7.94±n/a nM
Citation Furber, MAlcaraz, LLuckhurst, CBahl, ABeaton, HBowers, KCollington, JDenton, RDonald, DKinchin, EMacDonald, CRigby, ARiley, RSoars, MSpringthorpe, BWebborn, P Discovery and evolution of phenoxypiperidine hydroxyamide dual CCR3/H1 antagonists. Part I. Bioorg Med Chem Lett22:7702-6 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-C chemokine receptor type 3
Name:C-C chemokine receptor type 3
Synonyms:C-C CKR-3 | C-C chemokine receptor type 3 (CCR3) | CC-CKR-3 | CCR-3 | CCR3 | CD_antigen=CD193 | CKR3 | Eosinophil eotaxin receptor
Type:Enzyme
Mol. Mass.:41053.88
Organism:Homo sapiens (Human)
Description:P51677
Residue:355
Sequence:
MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILI
KYRRLRIMTNIYLLNLAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAVLAALPEFIFYETEELFEE
TLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTLLRCPSKKKYKAIRL
IFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLDLVMLVTEVIAYSHCCMNPVI
YAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50402822
NameBDBM50402822
Synonyms:CHEMBL2208434
TypeSmall organic molecule
Emp. Form.C24H25Cl2N3O4
Mol. Mass.490.379
SMILESO[C@H](CNC(=O)c1cc(=O)[nH]c2ccccc12)CN1CCC(CC1)Oc1ccc(Cl)c(Cl)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a