BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeprilysin
LigandBDBM50048514
Substrate/Competitorn/a
Meas. Tech.ChEMBL_144627
IC50 400±n/a nM
Citation Robl, JASimpkins, LMStevenson, JSun, CMurugesan, NBarrish, JCAsaad, MMBird, JSchaeffer, TRTrippodo, NCPetrillo, EWKaranewsky, DS Dual metalloprotease inhibitors. I. constrained peptidomimetics of mercaptoacyl dipeptides Bioorg Med Chem Lett4:1789-1794 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
Neprilysin
Name:Neprilysin
Synonyms:Atriopeptidase | CALLA | CD_antigen=CD10 | Common acute lymphocytic leukemia antigen | Enkephalinase | NEP | Neutral Endopeptidase (NEP) | Neutral endopeptidase | Neutral endopeptidase 24.11
Type:Enzyme
Mol. Mass.:85505.38
Organism:Homo sapiens (Human)
Description:P08473
Residue:750
Sequence:
MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKD
VLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGA
SWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLY
NKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPEYLTKLKPILT
KYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERI
GYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAA
VVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGLGQAYR
AYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII
GTLQNSAEFSEAFHCRKNSYMNPEKKCRVW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50048514
NameBDBM50048514
Synonyms:(S)-1-[(S)-2-((S)-2-Mercapto-3-phenyl-propionylamino)-propionyl]-pyrrolidine-2-carboxylic acid | CHEMBL287896
TypeSmall organic molecule
Emp. Form.C17H22N2O4S
Mol. Mass.350.433
SMILESC[C@H](NC(=O)[C@@H](S)Cc1ccccc1)C(=O)N1CCC[C@H]1C(O)=O
Structure
n/a