Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdrenergic receptor alpha
LigandBDBM50403743
Substrate/Competitorn/a
Meas. Tech.ChEMBL_32528
IC50 195±n/a nM
Citation Kennis, LEBischoff, FPMertens, CJLove, CJVan den Keybus, FAPieters, SBraeken, MMegens, AALeysen, JE New 2-substituted 1,2,3,4-tetrahydrobenzofuro[3,2-c]pyridine having highly active and potent central alpha 2-antagonistic activity as potential antidepressants. Bioorg Med Chem Lett10:71-4 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adrenergic receptor alpha
Name:Adrenergic receptor alpha
Synonyms:ADRA2B | ADRA2L1 | ADRA2RL1 | Alpha-2 adrenergic receptor subtype C2 | Alpha-2B adrenergic receptor | Alpha-2B adrenoceptor | Alpha-2B adrenoreceptor | Alpha-2BAR
Type:PROTEIN
Mol. Mass.:49964.20
Organism:Homo sapiens
Description:ChEMBL_104787
Residue:450
Sequence:
MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS
FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASV
ASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE
EEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRR
AQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSS
LNPVIYTIFNQDFRRAFRRILCRPWTQTAW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50403743
NameBDBM50403743
Synonyms:CHEMBL162058
TypeSmall organic molecule
Emp. Form.C24H25N3O4
Mol. Mass.419.473
SMILESCOc1cc2nc(C)c(CCN3CCc4oc5ccccc5c4C3)c(=O)n2cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a