Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-2B adrenergic receptor
LigandBDBM50403737
Substrate/Competitorn/a
Meas. Tech.ChEMBL_32528
IC50 11±n/a nM
Citation Kennis, LEBischoff, FPMertens, CJLove, CJVan den Keybus, FAPieters, SBraeken, MMegens, AALeysen, JE New 2-substituted 1,2,3,4-tetrahydrobenzofuro[3,2-c]pyridine having highly active and potent central alpha 2-antagonistic activity as potential antidepressants. Bioorg Med Chem Lett10:71-4 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-2B adrenergic receptor
Name:Alpha-2B adrenergic receptor
Synonyms:ADRA2B | ADRA2L1 | ADRA2L1 | ADRA2RL1 | Adrenergic alpha2B | Adrenergic receptor alpha | Adrenergic, alpha-2B-, receptor [Homo sapiens] | Alpha-2 adrenergic receptor subtype C2 | Alpha-2B adrenoceptor | Alpha-2B adrenoreceptor | Alpha-2BAR
Type:Enzyme
Mol. Mass.:49579.89
Organism:Homo sapiens (Human)
Description:P18089
Residue:450
Sequence:
MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS
FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASV
ASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE
EEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRR
AQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSS
LNPVIYTIFNQDFRRAFRRILCRPWTQTAW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50403737
NameBDBM50403737
Synonyms:CHEMBL165776
TypeSmall organic molecule
Emp. Form.C23H23N3O2
Mol. Mass.373.4476
SMILESCc1nc2ccccn2c(=O)c1CCCN1CCc2oc3ccccc3c2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a