Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOpioid receptor
LigandBDBM50403821
Substrate/Competitorn/a
Meas. Tech.ChEMBL_146343
Ki 0.320000±n/a nM
Citation Santagada, VBalboni, GCaliendo, GGuerrini, RSalvadori, SBianchi, CBryant, SDLazarus, LH Assessment of substitution in the second pharmacophore of Dmt-Tic analogues. Bioorg Med Chem Lett10:2745-8 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Opioid receptor
Name:Opioid receptor
Synonyms:DOR-1 | Delta-type opioid receptor | K56 | MSL-2 | OPIATE Delta | OPRD1
Type:Enzyme Catalytic Domain
Mol. Mass.:40577.25
Organism:MOUSE
Description:OPIATE Delta OPRD1 MOUSE::P32300
Residue:372
Sequence:
MELVPSARAELQSSPLVNLSDAFPSAFPSAGANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQEPGSLRRPRQATTRERVTAC
TPSDGPGGGAAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50403821
NameBDBM50403821
Synonyms:CHEMBL93891
TypeSmall organic molecule
Emp. Form.C21H23FN2O4
Mol. Mass.386.4167
SMILESCc1cc(O)cc(C)c1C[C@H](N)C(=O)N1Cc2ccc(F)cc2CC1C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a