Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-1A adrenergic receptor
LigandBDBM50073272
Substrate/Competitorn/a
Meas. Tech.ChEMBL_34042
Kd 11.75±n/a nM
Citation González-Gómez, JCSantana, LUriarte, EBrea, JVillazón, MLoza, MIDe Luca, MRivas, MEMontenegro, GYFontenla, JA New arylpiperazine derivatives with high affinity for alpha1A, D2 and 5-HT2A receptors. Bioorg Med Chem Lett13:175-8 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Alpha-1A adrenergic receptor
Name:Alpha adrenergic receptor 1A and 1B
Synonyms:Adrenaline | Adrenaline 1 | Alpha-1 adrenoreceptor | adrenergic Alpha1A
Type:Protein
Mol. Mass.:51620.15
Organism:Rattus norvegicus (Rat)
Description:P43140
Residue:466
Sequence:
MVLLSENASEGSNCTHPPAPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGVRALLCVWVLSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYVPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
VPAEGGGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQSSKHALGYTL
HPPSQALEGQHRDMVRIPVGSGETFYKISKTDGVCEWKFFSSMPQGSARITVPKDQSACT
TARVRSKSFLQVCCCVGSSAPRPEENHQVPTIKIHTISLGENGEEV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50073272
n/a
NameBDBM50073272
Synonyms:4-Methyl-7-[3-(4-phenyl-piperazin-1-yl)-propoxy]-chromen-2-one | CHEMBL52096
TypeSmall organic molecule
Emp. Form.C23H26N2O3
Mol. Mass.378.4641
SMILESCc1cc(=O)oc2cc(OCCCN3CCN(CC3)c3ccccc3)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: