Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin receptor 2a and 2b (5HT2A and 5HT2B)
LigandBDBM50024201
Substrate/Competitorn/a
Meas. Tech.ChEMBL_2898
Kd 3548.13±n/a nM
Citation Domelsmith, LNEaton, TAHouk, KNAnderson, GMGlennon, RAShulgin, ATCastagnoli, NKollman, PA Photoelectron spectra of psychotropic drugs. 6. Relationships between the physical properties and pharmacological actions of amphetamine analogues. J Med Chem24:1414-21 (1982) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin receptor 2a and 2b (5HT2A and 5HT2B)
Name:Serotonin receptor 2a and 2b (5HT2A and 5HT2B)
Synonyms:5-HT2B | 5-hydroxytryptamine receptor 2B | HTR2B | Serotonin 2b (5-HT2b) receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:53668.47
Organism:RAT
Description:5-HT2B HTR2B RAT::P30994
Residue:479
Sequence:
MASSYKMSEQSTISEHILQKTCDHLILTDRSGLKAESAAEEMKQTAENQGNTVHWAALLI
FAVIIPTIGGNILVILAVSLEKRLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEATW
PLPLALCPAWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQANQCNSRTTAFVKITVVWL
ISIGIAIPVPIKGIEADVVNAHNITCELTKDRFGSFMLFGSLAAFFAPLTIMIVTYFLTI
HALRKKAYLVRNRPPQRLTRWTVSTVLQREDSSFSSPEKMVMLDGSHKDKILPNSTDETL
MRRMSSAGKKPAQTISNEQRASKVLGIVFLFFLLMWCPFFITNVTLALCDSCNQTTLKTL
LQIFVWVGYVSSGVNPLIYTLFNKTFREAFGRYITCNYQATKSVKVLRKCSSTLYFGNSM
VENSKFFTKHGIRNGINPAMYQSPVRLRSSTIQSSSIILLNTFLTENDGDKVEDQVSYI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50024201
NameBDBM50024201
Synonyms:(+/-)2-(3,4-Dimethoxy-phenyl)-1-methyl-ethylamine | 2-(2,3-Dimethoxy-phenyl)-1-methyl-ethylamine | 2-(3,4-Dimethoxy-phenyl)-1-methyl-ethylamine | 2-(3,4-Dimethoxy-phenyl)-1-methyl-ethylamine(3,4-DMA) | CHEMBL277540
TypeSmall organic molecule
Emp. Form.C11H17NO2
Mol. Mass.195.2582
SMILESCOc1ccc(CC(C)N)cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a