Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-1 adrenergic receptor
LigandBDBM25761
Substrate/Competitorn/a
Meas. Tech.ChEMBL_37075
Kd 1.7±n/a nM
Citation Baldwin, JJChristy, MEDenny, GHHabecker, CNFreedman, MBLyle, PAPonticello, GSVarga, SLGross, DMSweet, CS Beta 1-selective adrenoceptor antagonists: examples of the 2-[4-[3-(substituted amino)-2-hydroxypropoxy]phenyl]imidazole class. 2. J Med Chem29:1065-80 (1986) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-1 adrenergic receptor
Name:Beta-1 adrenergic receptor
Synonyms:ADRB1 | Adrenergic receptor | adrenergic Beta1
Type:Enzyme Catalytic Domain
Mol. Mass.:50540.48
Organism:GUINEA PIG
Description:adrenergic Beta1 ADRB1 GUINEA PIG::B0FL73
Residue:467
Sequence:
MGAGVLALGASEPCNLSSTAPLPDGAATAARLLVPASPPASLLPPTSEGSEPLSPQWTAG
MGLLMVLIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARVLVC
TVWAISALVSFLPILMHWWRAEGDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPGRPPSPVPSPTPGSPRAATDPLANGRTSKRR
PSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANS
AFNPIIYCRSPDFRKAFQRLLCCARRAARRRHTAHGGRPRASGCLARSGPPPSPGAASDE
DEDAVGAAPPARLLEPWAGCNGGAATADSDWSLDEPGRAGFASESKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25761
NameBDBM25761
Synonyms:Anapriline | Avlocardyl | CHEMBL27 | PROPANOLOL(-) | PROPRANOLOL, d | PROPRANOLOL, l- | PROPRANOLOL,(+) | PROPRANOLOL,(-) | Propanolol | Propanolol,(+/-) | Propranolol | [2-hydroxy-3-(naphthalen-1-yloxy)propyl](propan-2-yl)amine
TypeSmall organic molecule
Emp. Form.C16H21NO2
Mol. Mass.259.3434
SMILESCC(C)NCC(O)COc1cccc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a