Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate reductase
LigandBDBM50405971
Substrate/Competitorn/a
Meas. Tech.ChEBML_54926
Ki 339±n/a nM
Citation Selassie, CDFang, ZXLi, RLHansch, CDebnath, GKlein, TELangridge, RKaufman, BT On the structure selectivity problem in drug design. A comparative study of benzylpyrimidine inhibition of vertebrate and bacterial dihydrofolate reductase via molecular graphics and quantitative structure-activity relationships. J Med Chem32:1895-905 (1989) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate reductase
Name:Dihydrofolate reductase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:18437.08
Organism:Lactobacillus casei
Description:ChEMBL_1357878
Residue:163
Sequence:
MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50405971
NameBDBM50405971
Synonyms:CHEMBL59369
TypeSmall organic molecule
Emp. Form.C12H14N4O2
Mol. Mass.246.2652
SMILESCOc1cc(Cc2cnc(N)nc2N)ccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a