Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate reductase
LigandBDBM50405973
Substrate/Competitorn/a
Meas. Tech.ChEBML_53614
Ki 9772±n/a nM
Citation Selassie, CDFang, ZXLi, RLHansch, CDebnath, GKlein, TELangridge, RKaufman, BT On the structure selectivity problem in drug design. A comparative study of benzylpyrimidine inhibition of vertebrate and bacterial dihydrofolate reductase via molecular graphics and quantitative structure-activity relationships. J Med Chem32:1895-905 (1989) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate reductase
Name:Dihydrofolate reductase
Synonyms:1.5.1.3 | DHFR
Type:n/a
Mol. Mass.:21652.69
Organism:Gallus gallus (Chicken)
Description:n/a
Residue:189
Sequence:
VRSLNSIVAVCQNMGIGKDGNLPWPPLRNEYKYFQRMTSTSHVEGKQNAVIMGKKTWFSI
PEKNRPLKDRINIVLSRELKEAPKGAHYLSKSLDDALALLDSPELKSKVDMVWIVGGTAV
YKAAMEKPINHRLFVTRILHEFESDTFFPEIDYKDFKLLTEYPGVPADIQEEDGIQYKFE
VYQKSVLAQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50405973
NameBDBM50405973
Synonyms:CHEMBL417095
TypeSmall organic molecule
Emp. Form.C11H11ClN4
Mol. Mass.234.685
SMILESNc1ncc(Cc2cccc(Cl)c2)c(N)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a