Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate reductase
LigandBDBM50405991
Substrate/Competitorn/a
Meas. Tech.ChEMBL_54726
Ki 145±n/a nM
Citation Selassie, CDLi, RLPoe, MHansch, C On the optimization of hydrophobic and hydrophilic substituent interactions of 2,4-diamino-5-(substituted-benzyl)pyrimidines with dihydrofolate reductase. J Med Chem34:46-54 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate reductase
Name:Dihydrofolate reductase
Synonyms:1.5.1.3 | Dihydrofolate reductase | folA | t0090
Type:PROTEIN
Mol. Mass.:17976.56
Organism:Salmonella enterica subsp. enterica serovar Typhi
Description:ChEMBL_13019
Residue:159
Sequence:
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRHTWESIGRPLPGRKNI
IISSQPGTDDRVQWVKSVDEAIAACGDAPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
GDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50405991
NameBDBM50405991
Synonyms:CHEMBL301089
TypeSmall organic molecule
Emp. Form.C12H14N4O2
Mol. Mass.246.2652
SMILESCOc1ccc(Cc2cnc(N)nc2N)cc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a