Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate reductase type 1
LigandBDBM50405956
Substrate/Competitorn/a
Meas. Tech.ChEBML_54571
Ki 11±n/a nM
Citation Selassie, CDLi, RLPoe, MHansch, C On the optimization of hydrophobic and hydrophilic substituent interactions of 2,4-diamino-5-(substituted-benzyl)pyrimidines with dihydrofolate reductase. J Med Chem34:46-54 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate reductase type 1
Name:Dihydrofolate reductase type 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:17574.87
Organism:Escherichia coli
Description:ChEMBL_54248
Residue:157
Sequence:
MKLSLMVAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMGALPNRKYA
VVTRSSFTSDNENVLIFPSIKDALTNLKKITDHVIVSGGGEIYKSLIDQVDTLHISTIDI
EPEGDVYFPEIPSNFRPVFTQDFASNINYSYQIWQKG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50405956
NameBDBM50405956
Synonyms:CHEMBL57383
TypeSmall organic molecule
Emp. Form.C13H16N4O4S
Mol. Mass.324.356
SMILESCOc1cc(Cc2cnc(N)nc2N)ccc1OS(C)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a