Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-1 adrenergic receptor
LigandBDBM50016897
Substrate/Competitorn/a
Meas. Tech.ChEMBL_37078
Kd 63096±n/a nM
Citation Huber, DEhrhardt, JDDecker, NHimber, JAndermann, GLeclerc, G Synthesis and ocular antihypertensive activity of new imidazolidine derivatives containing a beta-blocking side chain. J Med Chem34:3197-204 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-1 adrenergic receptor
Name:Beta-1 adrenergic receptor
Synonyms:ADRB1 | Adrenergic receptor | adrenergic Beta1
Type:Enzyme Catalytic Domain
Mol. Mass.:50540.48
Organism:GUINEA PIG
Description:adrenergic Beta1 ADRB1 GUINEA PIG::B0FL73
Residue:467
Sequence:
MGAGVLALGASEPCNLSSTAPLPDGAATAARLLVPASPPASLLPPTSEGSEPLSPQWTAG
MGLLMVLIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARVLVC
TVWAISALVSFLPILMHWWRAEGDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPGRPPSPVPSPTPGSPRAATDPLANGRTSKRR
PSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANS
AFNPIIYCRSPDFRKAFQRLLCCARRAARRRHTAHGGRPRASGCLARSGPPPSPGAASDE
DEDAVGAAPPARLLEPWAGCNGGAATADSDWSLDEPGRAGFASESKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50016897
NameBDBM50016897
Synonyms:2-(2,6-dichloroanilino)-1,3-diazacyclopentene-(2) | 2-(2,6-dichloroanilino)-2-imidazoline | CLONIDINE | N-(2,6-dichlorophenyl)-4,5-dihydro-1H-imidazol-2-amine | clonidine (amino form)
TypeSmall organic molecule
Emp. Form.C9H9Cl2N3
Mol. Mass.230.094
SMILESClc1cccc(Cl)c1\[#7]=[#6]-1\[#7]-[#6]-[#6]-[#7]-1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a