Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalpain1/2
LigandBDBM50406637
Substrate/Competitorn/a
Meas. Tech.ChEMBL_43485
IC50 1000±n/a nM
Citation Huang, ZMcGowan, EBDetwiler, TC Ester and amide derivatives of E64c as inhibitors of platelet calpains. J Med Chem35:2048-54 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calpain1/2
Name:Calpain1/2
Synonyms:Calpain -type | Calpain-1 (u-Calpain) | Calpain-1 catalytic subunit
Type:Protein
Mol. Mass.:81880.51
Organism:Homo sapiens (Human)
Description:n/a
Residue:714
Sequence:
MSEEIITPVYCTGVSAQVQKQRARELGLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEA
FPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHS
AEGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILK
ALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQVVSLIRMRNPWGE
VEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKS
RTIRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLDETDDPDDYGDRESGCSFV
LALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPAVHLKRDFFLANASRARSEQFINL
REVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTVELDDQIQANLPDEQVLSE
EEIDENFKALFRQLAGEDMEISVKELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRD
GNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELII
TRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50406637
NameBDBM50406637
Synonyms:CHEMBL61010
TypeSmall organic molecule
Emp. Form.C17H27Cl3N2O5
Mol. Mass.445.766
SMILESCC(C)CCNC(=O)[C@H](CC(C)C)NC(=O)[C@H]1O[C@@H]1C(=O)OCC(Cl)(Cl)Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a