Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAryl hydrocarbon receptor
LigandBDBM50408303
Substrate/Competitorn/a
Meas. Tech.ChEMBL_36196
EC50 6.61±n/a nM
Citation So, SSKarplus, M Three-dimensional quantitative structure-activity relationships from molecular similarity matrices and genetic neural networks. 2. Applications. J Med Chem40:4360-71 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aryl hydrocarbon receptor
Name:Aryl hydrocarbon receptor
Synonyms:AhR | Class E basic helix-loop-helix protein 76 | aryl hydrocarbon receptor precursor | bHLHe76
Type:PROTEIN
Mol. Mass.:96143.77
Organism:Homo sapiens
Description:ChEMBL_1503828
Residue:848
Sequence:
MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDV
INKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQ
ALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNP
SQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQ
GKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC
DAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIVFRLLTKNNRW
TWVQSNARLLYKNGRPDYIIVTQRPLTDEEGTEHLRKRNTKLPFMFTTGEAVLYEATNPF
PAIMDPLPLRTKNGTSGKDSATTSTLSKDSLNPSSLLAAMMQQDESIYLYPASSTSSTAP
FENNFFNESMNECRNWQDNTAPMGNDTILKHEQIDQPQDVNSFAGGHPGLFQDSKNSDLY
SIMKNLGIDFEDIRHMQNEKFFRNDFSGEVDFRDIDLTDEILTYVQDSLSKSPFIPSDYQ
QQQSLALNSSCMVQEHLHLEQQQQHHQKQVVVEPQQQLCQKMKHMQVNGMFENWNSNQFV
PFNCPQQDPQQYNVFTDLHGISQEFPYKSEMDSMPYTQNFISCNQPVLPQHSKCTELDYP
MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQH
THVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHHPSEARPFP
DLTSSGFL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50408303
NameBDBM50408303
Synonyms:CHEMBL137665
TypeSmall organic molecule
Emp. Form.C12H3Br5O2
Mol. Mass.578.671
SMILESBrc1cc2Oc3cc(Br)c(Br)c(Br)c3Oc2cc1Br
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a