Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM421
Substrate/Competitorn/a
Meas. Tech.ChEMBL_157864
Ki 0.83±n/a nM
Citation Boyer, FEVara Prasad, JVDomagala, JMEllsworth, ELGajda, CHagen, SEMarkoski, LJTait, BDLunney, EAPalovsky, AFerguson, DGraham, NHoller, THupe, DNouhan, CTummino, PJUrumov, AZeikus, EZeikus, GGracheck, SJSanders, JMVanderRoest, SBrodfuehrer, JIyer, KSinz, MGulnik, SV 5,6-Dihydropyran-2-ones possessing various sulfonyl functionalities: potent nonpeptidic inhibitors of HIV protease. J Med Chem43:843-58 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM421
NameBDBM421
Synonyms:CHEMBL169849 | Dihydropyran-2-one deriv. 26 | N-(5-tert-butyl-4-{[4-hydroxy-2-oxo-6-(2-phenylethyl)-6-(propan-2-yl)-5,6-dihydro-2H-pyran-3-yl]sulfanyl}-2-methylphenyl)methanesulfonamide
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure 
n/a