Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-1A adrenergic receptor
LigandBDBM50409689
Substrate/Competitorn/a
Meas. Tech.ChEMBL_34040
Kd 5.89±n/a nM
Citation Quaglia, WPigini, MPiergentili, AGiannella, MGentili, FMarucci, GCarrieri, ACarotti, APoggesi, ELeonardi, AMelchiorre, C Structure-activity relationships in 1,4-benzodioxan-related compounds. 7. Selectivity of 4-phenylchroman analogues for alpha(1)-adrenoreceptor subtypes. J Med Chem45:1633-43 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Alpha-1A adrenergic receptor
Name:Alpha adrenergic receptor 1A and 1B
Synonyms:Adrenaline | Adrenaline 1 | Alpha-1 adrenoreceptor | adrenergic Alpha1A
Type:Protein
Mol. Mass.:51620.15
Organism:Rattus norvegicus (Rat)
Description:P43140
Residue:466
Sequence:
MVLLSENASEGSNCTHPPAPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGVRALLCVWVLSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYVPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
VPAEGGGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQSSKHALGYTL
HPPSQALEGQHRDMVRIPVGSGETFYKISKTDGVCEWKFFSSMPQGSARITVPKDQSACT
TARVRSKSFLQVCCCVGSSAPRPEENHQVPTIKIHTISLGENGEEV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50409689
n/a
NameBDBM50409689
Synonyms:CHEMBL297106
TypeSmall organic molecule
Emp. Form.C25H27NO5
Mol. Mass.421.4856
SMILESCOc1cccc(OC)c1OCCNC[C@@H]1Oc2ccccc2O[C@H]1c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: