Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 2A6
LigandBDBM23989
Substrate/Competitorn/a
Meas. Tech.ChEMBL_572015
IC50 20989±n/a nM
Citation Roy, KRoy, PP Exploring QSAR and QAAR for inhibitors of cytochrome P450 2A6 and 2A5 enzymes using GFA and G/PLS techniques. Eur J Med Chem44:1941-51 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 2A6
Name:Cytochrome P450 2A6
Synonyms:Coumarin 7-hydroxylase | Cytochrome P450 2A6
Type:Protein
Mol. Mass.:56514.34
Organism:Homo sapiens (Human)
Description:P11509
Residue:494
Sequence:
MLASGMLLVALLVCLTVMVLMSVWQQRKSKGKLPPGPTPLPFIGNYLQLNTEQMYNSLMK
ISERYGPVFTIHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVVFSN
GERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIDALRGTGGANIDPTFFLSRTVSN
VISSIVFGDRFDYKDKEFLSLLRMMLGIFQFTSTSTGQLYEMFSSVMKHLPGPQQQAFQL
LQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFI
GGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYMEAVIHEIQ
RFGDVIPMSLARRVKKDTKFRDFFLPKGTEVFPMLGSVLRDPSFFSNPQDFNPQHFLNEK
GQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVGF
ATIPRNYTMSFLPR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23989
NameBDBM23989
Synonyms:1,2,3,4-tetrahydronaphthalen-2-one | CHEMBL191664 | dihydro-naphthalenone, 4e | dihydronaphthalenone
TypeSmall organic molecule
Emp. Form.C10H10O
Mol. Mass.146.1858
SMILESO=C1CCc2ccccc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a