Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdrenergic alpha1B
LigandBDBM50414399
Substrate/Competitorn/a
Meas. Tech.ChEMBL_574169
Ki 0.933±n/a nM
Citation Giardinà, DMartarelli, DSagratini, GAngeli, PBallinari, DGulini, UMelchiorre, CPoggesi, EPompei, P Doxazosin-related alpha1-adrenoceptor antagonists with prostate antitumor activity. J Med Chem52:4951-4 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adrenergic alpha1B
Name:Adrenergic receptor alpha
Synonyms:Alpha 1B-adrenoceptor | Alpha 1B-adrenoreceptor | Alpha-1B adrenergic receptor
Type:Enzyme
Mol. Mass.:56862.13
Organism:Homo sapiens (Human)
Description:P35368
Residue:520
Sequence:
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFV
RILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRT
LPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLT
EPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50414399
NameBDBM50414399
Synonyms:CHEMBL561851
TypeSmall organic molecule
Emp. Form.C27H35N5O5
Mol. Mass.509.5973
SMILESCOc1cc2nc(nc(N)c2cc1OC)N(C)CCCCCCN(C)C(=O)C1COc2ccccc2O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a