Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldehyde dehydrogenase
LigandBDBM50058655
Substrate/Competitorn/a
Meas. Tech.ChEMBL_592877
IC50 39810.72±n/a nM
Citation Kapanda, CNMuccioli, GGLabar, GPoupaert, JHLambert, DM Bis(dialkylaminethiocarbonyl)disulfides as potent and selective monoglyceride lipase inhibitors. J Med Chem52:7310-4 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldehyde dehydrogenase
Name:Aldehyde dehydrogenase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:56489.77
Organism:Rattus norvegicus
Description:ChEMBL_592877
Residue:519
Sequence:
MLRAALSTARRGPRLSRLLSAAATSAVPAPNQQPEVFCNQIFINNEWHDAVSKKTFPTVN
PSTGEVICQVAEGNKEDVDKAVKAAQAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTY
LAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGV
CGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIV
PGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMSDA
DMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRVVGNPFDSRTEQ
GPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTIAKEEIF
GPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVFGA
QSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50058655
NameBDBM50058655
Synonyms:1,1',1'',1'''-[disulfanediylbis(carbonothioylnitrilo)]tetraethane | 1,1'-dithiobis(N,N-diethylthioformamide) | Antabuse (TN) | CHEMBL964 | DISULFIRAM | N,N,N',N'-tetraethylthiuram disulfide | N,N-diethyl[(diethylcarbamothioyl)disulfanyl]carbothioamide (G5) | bis(diethylthiocarbamoyl) disulfide | cid_3117 | tetraethylthioperoxydicarbonic diamide | tetraethylthiuram disulfide | tetraethylthiuram disulphide
TypeSmall organic molecule
Emp. Form.C10H20N2S4
Mol. Mass.296.539
SMILESCCN(CC)C(=S)SSC(=S)N(CC)CC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a