Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG-protein coupled bile acid receptor 1
LigandBDBM50415407
Substrate/Competitorn/a
Meas. Tech.ChEMBL_608993
EC50 1±n/a nM
Citation Budzik, BWEvans, KAWisnoski, DDJin, JRivero, RASzewczyk, GRJayawickreme, CMoncol, DLYu, H Synthesis and structure-activity relationships of a series of 3-aryl-4-isoxazolecarboxamides as a new class of TGR5 agonists. Bioorg Med Chem Lett20:1363-7 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
G-protein coupled bile acid receptor 1
Name:G-protein coupled bile acid receptor 1
Synonyms:BG37 | M-BAR | TGR5 | hBG37 | hGPCR19
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:35260.02
Organism:Homo sapiens (human)
Description:CHO cells transiently transfected with hTGR5.
Residue:330
Sequence:
MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLA
GLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQP
PGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGA
AAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPY
VATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ
GLWGRASRDSPGPSIAYHPSSQSSVDLDLN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50415407
NameBDBM50415407
Synonyms:CHEMBL612138
TypeSmall organic molecule
Emp. Form.C19H17ClN2O3
Mol. Mass.356.803
SMILESCOc1cccc(c1)-c1noc(C)c1C(=O)N(C)c1ccc(Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a