Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-1 adrenergic receptor
LigandBDBM25771
Substrate/Competitorn/a
Meas. Tech.ChEMBL_634434
EC50 794±n/a nM
Citation Procopiou, PABarrett, VJBevan, NJBiggadike, KBox, PCButchers, PRCoe, DMConroy, REmmons, AFord, AJHolmes, DSHorsley, HKerr, FLi-Kwai-Cheung, AMLooker, BEMann, ISMcLay, IMMorrison, VSMutch, PJSmith, CETomlin, P Synthesis and structure-activity relationships of long-acting beta2 adrenergic receptor agonists incorporating metabolic inactivation: an antedrug approach. J Med Chem53:4522-30 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-1 adrenergic receptor
Name:Adrenergic receptor
Synonyms:B1AR | Beta-1 adrenoceptor | Beta-1 adrenoreceptor | adrenergic Beta1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:51338.40
Organism:Homo sapiens (human)
Description:n/a
Residue:477
Sequence:
MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAG
MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAP
LANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFV
FFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGP
PPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25771
NameBDBM25771
Synonyms:1-hydroxy-2-naphthoic acid;4-[1-hydroxy-2-[6-(4-phenylbutoxy)hexylamino]ethyl]-2-methylol-phenol | 4-(1-hydroxy-2-{[6-(4-phenylbutoxy)hexyl]amino}ethyl)-2-(hydroxymethyl)phenol | Aeromax | Salmeterol | Serevent | salmeterol xinafoate
TypeSmall organic molecule
Emp. Form.C25H37NO4
Mol. Mass.415.5656
SMILESOCc1cc(ccc1O)C(O)CNCCCCCCOCCCCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a
NameBDBM25771
Synonyms:1-hydroxy-2-naphthoic acid;4-[1-hydroxy-2-[6-(4-phenylbutoxy)hexylamino]ethyl]-2-methylol-phenol | 4-(1-hydroxy-2-{[6-(4-phenylbutoxy)hexyl]amino}ethyl)-2-(hydroxymethyl)phenol | Aeromax | Salmeterol | Serevent | salmeterol xinafoate
TypeSmall organic molecule
Emp. Form.C25H37NO4
Mol. Mass.415.5656
SMILESOCc1cc(ccc1O)C(O)CNCCCCCCOCCCCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: