Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUrotensin-2
LigandBDBM50416345
Substrate/Competitorn/a
Meas. Tech.ChEMBL_643307
EC50 1148.15±n/a nM
Citation Lehmann, FCurrier, EAOlsson, RMa, JNBurstein, ESHacksell, ULuthman, K Optimization of isochromanone based urotensin II receptor agonists. Bioorg Med Chem18:4844-54 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Urotensin-2
Name:Urotensin-2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:14297.49
Organism:Homo sapiens (Human)
Description:ChEMBL_643307
Residue:124
Sequence:
MYKLASCCLLFIGFLNPLLSLPLLDSREISFQLSAPHEDARLTPEELERASLLQILPEML
GAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFW
KYCV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50416345
NameBDBM50416345
Synonyms:CHEMBL1172234
TypeSmall organic molecule
Emp. Form.C25H25NO3
Mol. Mass.387.4709
SMILESCN(C)CCC1(Cc2ccccc2C(=O)O1)c1ccc(Oc2ccccc2)cc1
Structure
n/a