Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-2B adrenergic receptor
LigandBDBM50016897
Substrate/Competitorn/a
Meas. Tech.ChEMBL_684818
EC50 1175±n/a nM
Citation Del Bello, FMattioli, LGhelfi, FGiannella, MPiergentili, AQuaglia, WCardinaletti, CPerfumi, MThomas, RJZanelli, UMarchioro, CDal Cin, MPigini, M Fruitful adrenergica(2C)-agonism/a(2A)-antagonism combination to prevent and contrast morphine tolerance and dependence. J Med Chem53:7825-35 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-2B adrenergic receptor
Name:Alpha-2B adrenergic receptor
Synonyms:ADRA2L1 | ADRA2RL1 | Adrenergic alpha2B | Adrenergic receptor alpha | Adrenergic, alpha-2B-, receptor [Homo sapiens] | Alpha-2 adrenergic receptor subtype C2 | Alpha-2B adrenoceptor | Alpha-2B adrenoreceptor | Alpha-2BAR
Type:Enzyme
Mol. Mass.:49579.89
Organism:Homo sapiens (Human)
Description:P18089
Residue:447
Sequence:
MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS
FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASV
ASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE
EEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQL
TREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSSLNP
VIYTIFNQDFRRAFRRILCRPWTQTAW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50016897
NameBDBM50016897
Synonyms:2-(2,6-dichloroanilino)-1,3-diazacyclopentene-(2) | 2-(2,6-dichloroanilino)-2-imidazoline | CLONIDINE | N-(2,6-dichlorophenyl)-4,5-dihydro-1H-imidazol-2-amine | clonidine (amino form)
TypeSmall organic molecule
Emp. Form.C9H9Cl2N3
Mol. Mass.230.094
SMILESClc1cccc(Cl)c1\[#7]=[#6]-1\[#7]-[#6]-[#6]-[#7]-1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a
NameBDBM50016897
Synonyms:2-(2,6-dichloroanilino)-1,3-diazacyclopentene-(2) | 2-(2,6-dichloroanilino)-2-imidazoline | CLONIDINE | N-(2,6-dichlorophenyl)-4,5-dihydro-1H-imidazol-2-amine | clonidine (amino form)
TypeSmall organic molecule
Emp. Form.C9H9Cl2N3
Mol. Mass.230.094
SMILESClc1cccc(Cl)c1\[#7]=[#6]-1\[#7]-[#6]-[#6]-[#7]-1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: