Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdrenergic alpha1B
LigandBDBM50417538
Substrate/Competitorn/a
Meas. Tech.ChEMBL_693738
Ki 31.62±n/a nM
Citation Sagratini, GAngeli, PBuccioni, MGulini, UMarucci, GMelchiorre, CPoggesi, EGiardinà, D Synthesis anda1-adrenoceptor antagonist activity of tamsulosin analogues. Eur J Med Chem45:5800-7 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adrenergic alpha1B
Name:Adrenergic receptor alpha
Synonyms:Alpha 1B-adrenoceptor | Alpha 1B-adrenoreceptor | Alpha-1B adrenergic receptor
Type:Enzyme
Mol. Mass.:56862.13
Organism:Homo sapiens (Human)
Description:P35368
Residue:520
Sequence:
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFV
RILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRT
LPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLT
EPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50417538
NameBDBM50417538
Synonyms:CHEMBL1630942
TypeSmall organic molecule
Emp. Form.C20H26N2O5S
Mol. Mass.406.496
SMILESCOc1ccc(C[C@@H](C)NC[C@@H]2Oc3ccccc3O[C@@H]2C)cc1S(N)(=O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a