Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A3
LigandBDBM50094696
Substrate/Competitorn/a
Meas. Tech.ChEMBL_701308
Ki 141.25±n/a nM
Citation Pran Kishore, DBalakumar, CRaghuram Rao, ARoy, PPRoy, K QSAR of adenosine receptor antagonists: Exploring physicochemical requirements for binding of pyrazolo[4,3-e]-1,2,4-triazolo[1,5-c]pyrimidine derivatives with human adenosine A(3) receptor subtype. Bioorg Med Chem Lett21:818-23 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A3
Name:Adenosine receptor A3
Synonyms:A3 adenosine receptor (hA3) | Adenosine A3 receptor (A3AR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36197.32
Organism:Homo sapiens (Human)
Description:P0DMS8
Residue:318
Sequence:
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50094696
NameBDBM50094696
Synonyms:1-(2-(furan-2-yl)-8H-pyrazolo[4,3-e][1,2,4]triazolo[1,5-c]pyrimidin-5-yl)-3-(4-methoxyphenyl)urea | 1-(2-Furan-2-yl-8H-pyrazolo[4,3-e][1,2,4]triazolo[1,5-c]pyrimidin-5-yl)-3-(4-methoxy-phenyl)-urea | CHEMBL145767
TypeSmall organic molecule
Emp. Form.C18H14N8O3
Mol. Mass.390.3556
SMILESCOc1ccc(NC(=O)Nc2nc3n[nH]cc3c3nc(nn23)-c2ccco2)cc1
Structure
n/a