Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine receptor D2L/neurotensin receptor NTS1
LigandBDBM86453
Substrate/Competitorn/a
Meas. Tech.ChEMBL_759383
IC50<10000±n/a nM
Citation Connolly, SAlcaraz, LBailey, ACadogan, EChristie, JCook, ARFisher, AJHill, SHumphries, AIngall, AHKane, ZPaine, SPairaudeau, GStocks, MJYoung, A Design-driven LO: the discovery of new ultra long acting dibasicß2-adrenoceptor agonists. Bioorg Med Chem Lett21:4612-6 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dopamine receptor D2L/neurotensin receptor NTS1
Name:Dopamine receptor D2L/neurotensin receptor NTS1
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DRD2 | Dopamine D2 receptor | Dopamine D2 receptor (D2) | Dopamine D2 receptor (D2R) | Dopamine D2A | Dopamine2-like
Type:Cell-surface receptors
Mol. Mass.:50647.10
Organism:Homo sapiens (Human)
Description:P14416
Residue:443
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86453
NameBDBM86453
Synonyms:CAS_73573-87-2 | Formoterol | NSC_3083544
TypeSmall organic molecule
Emp. Form.C19H24N2O4
Mol. Mass.344.4049
SMILESCOc1ccc(CC(C)NCC(O)c2ccc(O)c(NC=O)c2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a
NameBDBM86453
Synonyms:CAS_73573-87-2 | Formoterol | NSC_3083544
TypeSmall organic molecule
Emp. Form.C19H24N2O4
Mol. Mass.344.4049
SMILESCOc1ccc(CC(C)NCC(O)c2ccc(O)c(NC=O)c2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: