Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-1 adrenergic receptor
LigandBDBM25771
Substrate/Competitorn/a
Meas. Tech.ChEMBL_761248
EC50 794±n/a nM
Citation Procopiou, PABarrett, VJBevan, NJButchers, PRConroy, REmmons, AFord, AJJeulin, SLooker, BELunniss, GEMorrison, VSMutch, PJPerciaccante, RRuston, MSmith, CESomers, G The discovery of long-acting saligeninß2 adrenergic receptor agonists incorporating hydantoin or uracil rings. Bioorg Med Chem19:4192-201 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-1 adrenergic receptor
Name:Adrenergic receptor
Synonyms:B1AR | Beta-1 adrenoceptor | Beta-1 adrenoreceptor | adrenergic Beta1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:51338.40
Organism:Homo sapiens (human)
Description:n/a
Residue:477
Sequence:
MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAG
MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAP
LANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFV
FFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGP
PPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25771
NameBDBM25771
Synonyms:1-hydroxy-2-naphthoic acid;4-[1-hydroxy-2-[6-(4-phenylbutoxy)hexylamino]ethyl]-2-methylol-phenol | 4-(1-hydroxy-2-{[6-(4-phenylbutoxy)hexyl]amino}ethyl)-2-(hydroxymethyl)phenol | Aeromax | Salmeterol | Serevent | salmeterol xinafoate
TypeSmall organic molecule
Emp. Form.C25H37NO4
Mol. Mass.415.5656
SMILESOCc1cc(ccc1O)C(O)CNCCCCCCOCCCCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a
NameBDBM25771
Synonyms:1-hydroxy-2-naphthoic acid;4-[1-hydroxy-2-[6-(4-phenylbutoxy)hexylamino]ethyl]-2-methylol-phenol | 4-(1-hydroxy-2-{[6-(4-phenylbutoxy)hexyl]amino}ethyl)-2-(hydroxymethyl)phenol | Aeromax | Salmeterol | Serevent | salmeterol xinafoate
TypeSmall organic molecule
Emp. Form.C25H37NO4
Mol. Mass.415.5656
SMILESOCc1cc(ccc1O)C(O)CNCCCCCCOCCCCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: