Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSolute carrier family 22 member 6
LigandBDBM50420185
Substrate/Competitorn/a
Meas. Tech.ChEMBL_836508
Ki 23000±n/a nM
Citation Enomoto, ATakeda, MTaki, KTakayama, FNoshiro, RNiwa, TEndou, H Interactions of human organic anion as well as cation transporters with indoxyl sulfate. Eur J Pharmacol466:13-20 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Solute carrier family 22 member 6
Name:Solute carrier family 22 member 6
Synonyms:Organic anion transporter 1 | PAH transporter | Renal organic anion transporter 1 | hOAT1 | hPAHT | hROAT1
Type:PROTEIN
Mol. Mass.:61831.78
Organism:Homo sapiens
Description:ChEMBL_1487359
Residue:563
Sequence:
MAFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRPPADANLSKN
GGLEVWLPRDRQGQPESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTI
VTEWDLVCSHRALRQLAQSLYMVGVLLGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAA
FAPNFPIYCAFRLLSGMALAGISLNCMTLNVEWMPIHTRACVGTLIGYVYSLGQFLLAGV
AYAVPHWRHLQLLVSAPFFAFFIYSWFFIESARWHSSSGRLDLTLRALQRVARINGKREE
GAKLSMEVLRASLQKELTMGKGQASAMELLRCPTLRHLFLCLSMLWFATSFAYYGLVMDL
QGFGVSIYLIQVIFGAVDLPAKLVGFLVINSLGRRPAQMAALLLAGICILLNGVIPQDQS
IVRTSLAVLGKGCLAASFNCIFLYTGELYPTMIRQTGMGMGSTMARVGSIVSPLVSMTAE
LYPSMPLFIYGAVPVAASAVTVLLPETLGQPLPDTVQDLESRWAPTQKEAGIYPRKGKQT
RQQQEHQKYMVPLQASAQEKNGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50420185
NameBDBM50420185
Synonyms:CHEMBL1233636
TypeSmall organic molecule
Emp. Form.C8H7NO4S
Mol. Mass.213.21
SMILESOS(=O)(=O)Oc1c[nH]c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a