Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSolute carrier family 22 member 6
LigandBDBM50420231
Substrate/Competitorn/a
Meas. Tech.ChEMBL_836628
Ki 2740±n/a nM
Citation Hasegawa, MKusuhara, HSugiyama, DIto, KUeda, SEndou, HSugiyama, Y Functional involvement of rat organic anion transporter 3 (rOat3; Slc22a8) in the renal uptake of organic anions. J Pharmacol Exp Ther300:746-53 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Solute carrier family 22 member 6
Name:Solute carrier family 22 member 6
Synonyms:Organic anion transporter 1 | rOAT1 | rROAT1 | renal organic anion transporter 1
Type:PROTEIN
Mol. Mass.:60784.17
Organism:Rattus norvegicus
Description:ChEMBL_838479
Residue:551
Sequence:
MAFNDLLKQVGGVGRFQLIQVTMVVAPLLLMASHNTLQNFTAAIPPHHCRPPANANLSKD
GGLEAWLPLDKQGQPESCLRFTSPQWGPPFYNGTEANGTRVTEPCIDGWVYDNSTFPSTI
VTEWNLVCSHRAFRQLAQSLYMVGVLLGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAA
YAPNYTVYCVFRLLSGMSLASIAINCMTLNVEWMPIHTRAYVGTLIGYVYSLGQFLLAGI
AYAVPHWRHLQLVVSVPFFIAFIYSWFFIESARWYSSSGRLDLTLRALQRVARINGKQEE
GAKLSIEVLRTSLQKELTLSKGQASAMELLRCPTLRHLFLCLSMLWFATSFAYYGLVMDL
QGFGVSMYLIQVIFGAVDLPAKFVCFLVINSMGRRPAQMASLLLAGICILVNGIIPKSHT
IIRTSLAVLGKGCLASSFNCIFLYTGELYPTVIRQTGLGMGSTMARVGSIVSPLVSMTAE
FYPSMPLFIFGAVPVVASAVTALLPETLGQPLPDTVQDLKSRSRGKQNQQQQEQQKQMMP
LQASTQEKNGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50420231
NameBDBM50420231
Synonyms:CHEMBL2074600
TypeSmall organic molecule
Emp. Form.C20H12Br2O10S2
Mol. Mass.636.241
SMILESOS(=O)(=O)Oc1ccc(cc1)C1(OC(=O)c2c1c(Br)ccc2Br)c1ccc(OS(O)(=O)=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a