Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-2B adrenergic receptor
LigandBDBM50420342
Substrate/Competitorn/a
Meas. Tech.ChEMBL_840150
EC50 1585±n/a nM
Citation Del Bello, FDiamanti, EGiannella, MMammoli, VMarchioro, CMattioli, LTitomanlio, FPiergentili, AQuaglia, WBenedetti, GVarrone, MPigini, M Low Doses of Allyphenyline and Cyclomethyline, Effective against Morphine Dependence, Elicit an Antidepressant-like Effect. ACS Med Chem Lett3:535-539 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-2B adrenergic receptor
Name:Alpha-2B adrenergic receptor
Synonyms:ADRA2B | ADRA2L1 | ADRA2L1 | ADRA2RL1 | Adrenergic alpha2B | Adrenergic receptor alpha | Adrenergic, alpha-2B-, receptor [Homo sapiens] | Alpha-2 adrenergic receptor subtype C2 | Alpha-2B adrenoceptor | Alpha-2B adrenoreceptor | Alpha-2BAR
Type:Enzyme
Mol. Mass.:49579.89
Organism:Homo sapiens (Human)
Description:P18089
Residue:450
Sequence:
MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS
FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASV
ASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE
EEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRR
AQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSS
LNPVIYTIFNQDFRRAFRRILCRPWTQTAW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50420342
NameBDBM50420342
Synonyms:CHEMBL2089156
TypeSmall organic molecule
Emp. Form.C15H20N2O
Mol. Mass.244.3321
SMILESC[C@H](Oc1ccccc1CC1CC1)C1=NCCN1 |r,t:15|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a