Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTransient receptor potential M8 protein (TRPM8)
LigandBDBM50420681
Substrate/Competitorn/a
Meas. Tech.ChEMBL_842361
IC50 1900±n/a nM
Citation Ortar, GMorera, LMoriello, ASMorera, ENalli, MDi Marzo, VDe Petrocellis, L Modulation of thermo-transient receptor potential (thermo-TRP) channels by thymol-based compounds. Bioorg Med Chem Lett22:3535-9 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Transient receptor potential M8 protein (TRPM8)
Name:Transient receptor potential M8 protein (TRPM8)
Synonyms:Transient receptor potential cation channel subfamily M member 8
Type:Enzyme
Mol. Mass.:127633.53
Organism:Rattus norvegicus (Rat)
Description:Q8R455
Residue:1104
Sequence:
MSFEGARLSMRSRRNGTLGSTRTLYSSVSRSTDVSYSESDLVNFIQANFKKRECVFFTRD
SKAMESICKCGYAQSQHIEGTQINQNEKWNYKKHTKEFPTDAFGDIQFETLGKKGKYLRL
SCDTDSETLYELLTQHWHLKTPNLVISVTGGAKNFALKPRMRKIFSRLIYIAQSKGAWIL
TGGTHYGLMKYIGEVVRDNTISRNSEENIVAIGIAAWGMVSNRDTLIRNCDDEGHFSAQY
IMDDFMRDPLYILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTSQDSNYGGKIP
IVCFAQGGGRETLKAINTSVKSKIPCVVVEGSGQIADVIASLVEVEDVLTSSMVKEKLVR
FLPRTVSRLPEEEIESWIKWLKEILESPHLLTVIKMEEAGDEVVSSAISYALYKAFSTNE
QDKDNWNGQLKLLLEWNQLDLASDEIFTNDRRWESADLQEVMFTALIKDRPKFVRLFLEN
GLNLQKFLTNEVLTELFSTHFSTLVYRNLQIAKNSYNDALLTFVWKLVANFRRSFWKEDR
SSREDLDVELHDASLTTRHPLQALFIWAILQNKKELSKVIWEQTKGCTLAALGASKLLKT
LAKVKNDINAAGESEELANEYETRAVELFTECYSSDEDLAEQLLVYSCEAWGGSNCLELA
VEATDQHFIAQPGVQNFLSKQWYGEISRDTKNWKIILCLFIIPLVGCGLVSFRKKPIDKH
KKLLWYYVAFFTSPFVVFSWNVVFYIAFLLLFAYVLLMDFHSVPHTPELILYALVFVLFC
DEVRQWYMNGVNYFTDLWNVMDTLGLFYFIAGIVFRLHSSNKSSLYSGRVIFCLDYIIFT
LRLIHIFTVSRNLGPKIIMLQRMLIDVFFFLFLFAVWMVAFGVARQGILRQNEQRWRWIF
RSVIYEPYLAMFGQVPSDVDSTTYDFSHCTFSGNESKPLCVELDEYNLPRFPEWITIPLV
CIYMLSTNILLVNLLVAMFGYTVGIVQENNDQVWKFQRYFLVQEYCNRLNIPFPFVVFAY
FYMVVKKCFKCCCKEKNTESSACCFRNEDNETLAWEGVMKENYLVKINTKANDNAEEMRH
RFRQLDTKLNDLKGLLKEIANKIK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50420681
n/a
NameBDBM50420681
Synonyms:CHEMBL2087052
TypeSmall organic molecule
Emp. Form.C21H27NO
Mol. Mass.309.4452
SMILESCC(C)c1ccc(C)cc1C(=O)Nc1ccc(cc1)C(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: