Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetmetallo-beta-lactamase IMP-1
LigandBDBM21642
Substrate/Competitorn/a
Meas. Tech.ChEMBL_839905
Ki 2400±n/a nM
Citation Chen, PHorton, LBMikulski, RLDeng, LSundriyal, SPalzkill, TSong, Y 2-Substituted 4,5-dihydrothiazole-4-carboxylic acids are novel inhibitors of metallo-ß-lactamases. Bioorg Med Chem Lett22:6229-32 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
metallo-beta-lactamase IMP-1
Name:Beta-lactamase
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:27125.88
Organism:Pseudomonas aeruginosa
Description:gi_27368096
Residue:246
Sequence:
MSKLSVFFIFLFCSIATAAESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNA
EAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELT
NELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKP
YGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKK
PSKPSN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21642
NameBDBM21642
Synonyms:(2S)-1-[(2S)-2-methyl-3-sulfanylpropanoyl]pyrrolidine-2-carboxylic acid | CHEMBL1560 | Capozide | Captopril | Lopirin | SQ 14,225 | SQ14534
TypeSmall organic molecule
Emp. Form.C9H15NO3S
Mol. Mass.217.285
SMILESC[C@H](CS)C(=O)N1CCC[C@H]1C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a